Protein Info for BWI76_RS10050 in Klebsiella michiganensis M5al

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 45 to 181 (137 residues), 160.1 bits, see alignment E=1.5e-51 PF01161: PBP" amino acids 46 to 180 (135 residues), 140.6 bits, see alignment E=2.1e-45

Best Hits

Swiss-Prot: 59% identical to YBCL_ECOLI: UPF0098 protein YbcL (ybcL) from Escherichia coli (strain K12)

KEGG orthology group: K06910, (no description) (inferred from 78% identity to kpn:KPN_01002)

Predicted SEED Role

"Protein ybcL precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1Z5 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BWI76_RS10050 outer membrane protein (Klebsiella michiganensis M5al)
MKTGLKVAAAIMVMISGTAIAAPFSVSSADMREGDALAQRHWFGGFGCTGGNISPQIAWQ
NAPAGTRSFAVTAYDPDAPTGSGWWHWTVVNIAQQATSLAAGAGDKNNAKLPAGAVQGRN
DFGYAGFGGACPPAGDKPHRYRFTVWALDIPTLPIDGESSGALVGFMLHSHAIASAQITA
MAGR