Protein Info for BWI76_RS09710 in Klebsiella michiganensis M5al

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF13292: DXP_synthase_N" amino acids 2 to 179 (178 residues), 55.5 bits, see alignment E=8.4e-19 PF00456: Transketolase_N" amino acids 20 to 258 (239 residues), 146.7 bits, see alignment E=1.3e-46 PF00676: E1_dh" amino acids 108 to 212 (105 residues), 29.6 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 37% identical to APTA_ACTSZ: Apulose-4-phosphate transketolase subunit A (aptA) from Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 89% identity to cro:ROD_09661)

MetaCyc: 37% identical to apulose-4-phosphate transketolase subunit A (Actinobacillus succinogenes 130Z)
RXN-20930 [EC: 2.2.1.13]

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1 or 2.2.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1L3 at UniProt or InterPro

Protein Sequence (265 amino acids)

>BWI76_RS09710 transketolase (Klebsiella michiganensis M5al)
MNIDELKSHALAARREIVTLIYESGIGHPGGALSIIDILTWLYYQEVDLAASPRSRVVMS
KGHAVAAQYAMLYQKGKIDRSEFSTFRQINSRLQGHPSIKSLPEVDATTGLLGQGLSIAL
GMAAAKKRRNDPHRVFAIVGDGEMHEGQIWETLQQAGHMKMDNLVAIIDYNGFSSHDPVN
EVVNLEPLADKIRSFGWHVLELHNGNDMHQVADTLMLSRHLKGKPVAIVAHTTKGSGVSY
MENNGDWHSKTPSKEQFQQAMEELQ