Protein Info for BWI76_RS09690 in Klebsiella michiganensis M5al

Annotation: dimethyl sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details PF04976: DmsC" amino acids 1 to 277 (277 residues), 389.3 bits, see alignment E=5.3e-121

Best Hits

Swiss-Prot: 79% identical to DMSC_ECOLI: Anaerobic dimethyl sulfoxide reductase chain C (dmsC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_15105)

MetaCyc: 79% identical to dimethyl sulfoxide reductase subunit C (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1K9 at UniProt or InterPro

Protein Sequence (287 amino acids)

>BWI76_RS09690 dimethyl sulfoxide reductase (Klebsiella michiganensis M5al)
MGSGWHEWPLIIFTVFGQCVVGGFIVLALALMKGDLSREQQQRVVWSMFGLWVLMGVGFI
ASTLHLGSPMRAFNSLNRVGASSLSNEIASGALFFAVGGIGWLLAVVNKLPAGLRHLWLI
ITMVLGVIFVWMMVRVYNTIDTVPTWYTVWTPLSFFLTMFIGGPLLGYLLLRVADVTGWA
MRLLPAVTLLALVISAIVGLMQGSELATIHSSIQQASVLVPDYGSLMAWRLVALALALVC
WIAPQLKGYQPALPMLGLAFVLMLVGEMIGRGVFYGLHMTVGMAIAS