Protein Info for BWI76_RS09570 in Klebsiella michiganensis M5al

Annotation: hydroxylamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 TIGR01703: hydroxylamine reductase" amino acids 1 to 548 (548 residues), 766.7 bits, see alignment E=5.4e-235 PF03063: Prismane" amino acids 1 to 545 (545 residues), 507.5 bits, see alignment E=2.1e-156

Best Hits

Swiss-Prot: 96% identical to HCP_KLEP3: Hydroxylamine reductase (hcp) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_15000)

MetaCyc: 95% identical to protein S-nitrosylase (Escherichia coli K-12 substr. MG1655)
Hydroxylamine reductase. [EC: 1.7.99.1]

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.- or 1.7.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1A5 at UniProt or InterPro

Protein Sequence (550 amino acids)

>BWI76_RS09570 hydroxylamine reductase (Klebsiella michiganensis M5al)
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIASLQGLSAWALKAREYGIIDH
DIDSFAPRAFFSTLTNVNFDSPRIVGYAREAITLREALKARCLNIDAHATVDNPMADLQL
VSDDLGDLQHQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNAIY
AQYHKIMAWLGTWPADMNALLECSMEIGQMNFKVMSILDAGETSKYGHPTPTQVNVKATE
GKCILISGHDLKDLYNLLEQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQ
QVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVNHLEGEDFAPVIAQAQQMA
GFPYSEIPHLITVGFGRQTLLGAADTLIDLVSREKLRHIFLVGGCDGARGERNYFTDFAT
SVPDDCLILTLACGKYRFNKLEFGDIEGLPRLVDAGQCNDAYSAIILAVTLAEKLGCGVN
DLPLSLVLSWFEQKAIVILLTLLSLGVKNIVTGPTAPGFFTPDLLAVLNEKFGLRSVTTV
EEDMKQLLSA