Protein Info for BWI76_RS09545 in Klebsiella michiganensis M5al

Annotation: NAD-dependent epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 445 to 463 (19 residues), see Phobius details PF05368: NmrA" amino acids 1 to 122 (122 residues), 45.8 bits, see alignment E=1.3e-15 PF01370: Epimerase" amino acids 5 to 120 (116 residues), 55 bits, see alignment E=1.7e-18 PF13460: NAD_binding_10" amino acids 9 to 132 (124 residues), 55.1 bits, see alignment E=1.9e-18 PF11066: DUF2867" amino acids 333 to 463 (131 residues), 58.6 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 80% identical to YBJT_ECOLI: Putative NAD(P)-binding protein YbjT (ybjT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_14970)

Predicted SEED Role

"FIG00731418: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1A7 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BWI76_RS09545 NAD-dependent epimerase/dehydratase (Klebsiella michiganensis M5al)
MSQRILVLGASGYIGQHLVKRLSEQGFTVLAAARHIDRLKKQHLPGVECYSLDLNQPEAL
PDLLAQADTVYYLVHGMGEGGDFIRHERQVALNVRDALRETPVNEVIFLSSLQVAEQEQS
DHLRARQITGDLLRESGVPVAEVRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTT
PIALENLLYYLLRLLDHPSREHRVFEAAGPETLSYQQQFIRFMAVSGKRRPLIPVPFPTR
WISVWFLNVITSVPPTTAKALIQGLKHDLIADDRALRALIPQPLIAFDEAVRRTLKEEEQ
LVNSSDWGYDAQAFARWRPEYGYYPKQAGCTVNTSASSGALWEVINQIGGKEGYFFGNVL
WKTRGAMDLLVGHRLAKGRPERAYLQTGDAVDSWKVIIVEPEKQLTLLFGMKAPGLGRLS
FTLRDKGDHRELDVRAWWHPHGMPGLFYWLLMIPAHLFIFRGMARRIAHLAEQITIK