Protein Info for BWI76_RS09515 in Klebsiella michiganensis M5al

Annotation: arginine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 3 to 241 (239 residues), 310.1 bits, see alignment E=5.6e-97 PF00497: SBP_bac_3" amino acids 23 to 242 (220 residues), 143 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 91% identical to ARTI_ECOLI: Putative ABC transporter arginine-binding protein 2 (artI) from Escherichia coli (strain K12)

KEGG orthology group: K09997, arginine transport system substrate-binding protein (inferred from 93% identity to set:SEN0835)

MetaCyc: 64% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtI" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1H3 at UniProt or InterPro

Protein Sequence (243 amino acids)

>BWI76_RS09515 arginine ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MKKVLIAALLAGMSLSATAAQTIRFATEASYPPFESIDANNKIVGFDVDLANALCKEIDA
TCTFTNQAFDSLIPSLKFRRFDAVMAGMDITPEREKQVLFTTPYYENSALFVGQQGKFTS
IDALKGKKVGVQNGTTHQKFITDKHPEITTVPYDSYQNAKLDLQNGRIDAVFGDTAVVTE
WLKSNPKLAAVGDKVTDKDYFGTGLGIALRQGNTELQQKFNAALEKVKSDGTYQSIYNKW
FQK