Protein Info for BWI76_RS09365 in Klebsiella michiganensis M5al

Annotation: phage tail sheath protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04984: Phage_sheath_1
  • amino acids 108 to 273 (166 residues), 109.5 bits, E=1.6e-35
• PF17482: Phage_sheath_1C
  • amino acids 275 to 377 (103 residues), 76.5 bits, E=1.5e-25

Best Hits

Swiss-Prot: 67% identical to TSP_BPP2: Tail sheath protein (FI) from Escherichia phage P2

KEGG orthology group: K06907, (no description) (inferred from 92% identity to sek:SSPA2385)

Predicted SEED Role

"Phage tail sheath monomer"

Protein Sequence (390 amino acids)

>BWI76_RS09365 phage tail sheath protein (Klebsiella michiganensis M5al)
MAQDYHHGVRVVEVNDGTRSITTVSTAIVGMVCTGDDADASMFPLNKPVLLTDVLTASGK
AGESGTLARSLDAIADQAKPVTVVVRVAQGETEAETTSNIIGGVTADGKKTGMKALLSAQ
SQLGVKPRILGVPGHDTQAVSTELLSVAQSLRAFAYMSAYGCKTVAEAITYRDNFSQREG
MLIWPDFINFDTVLQADTTAYATARALGLRAKIDEQTGWHKTLSNVGVNGVTGLSADVFW
DLQDPATDAGLLNQNDVTTLIRKDGFRFWGSRCLSDDPLFQFENYTRTAQVLADTMAEGH
MWAVDMPLNPSLARDIIEGIRAKMRSLVNQGYLIGGDCWIDDSVNDKDTLKAGKLWIDYD
YTPVPPLENLMLRQRITDRYLVDFTTRVSA