Protein Info for BWI76_RS09320 in Klebsiella michiganensis M5al

Annotation: P2 phage tail completion protein R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF06891: P2_Phage_GpR" amino acids 1 to 131 (131 residues), 158 bits, see alignment E=7.6e-51

Best Hits

Swiss-Prot: 53% identical to VPR_BPP2: Tail completion protein R (R) from Escherichia phage P2

KEGG orthology group: None (inferred from 85% identity to enc:ECL_04415)

Predicted SEED Role

"Phage tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>BWI76_RS09320 P2 phage tail completion protein R (Klebsiella michiganensis M5al)
MNKPQSLRLALNSAVAYVRDNPDKLHLFVDNGSVVATGAASLSWEYRYTLNVVVVDFSGD
QGLLMAPVLAWLMENQPDAIHNPEHREKLFTFEVDILRNDICDISLNLQLTERVIVSADG
NLSRVEAVPEPDEPDEMWAVHRG