Protein Info for BWI76_RS09040 in Klebsiella michiganensis M5al

Annotation: ABC-F family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 71.5 bits, see alignment E=2.8e-23 amino acids 336 to 467 (132 residues), 85.8 bits, see alignment E=1.1e-27 PF12848: ABC_tran_Xtn" amino acids 224 to 309 (86 residues), 75.1 bits, see alignment E=9.2e-25

Best Hits

Swiss-Prot: 94% identical to YBIT_ECOL6: Uncharacterized ABC transporter ATP-binding protein YbiT (ybiT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 97% identity to kva:Kvar_3527)

Predicted SEED Role

"Putative ATPase component of ABC transporter with duplicated ATPase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B159 at UniProt or InterPro

Protein Sequence (530 amino acids)

>BWI76_RS09040 ABC-F family ATPase (Klebsiella michiganensis M5al)
MLVSSNVTMQFGSKPLFENISVKFGGGNRYGLIGANGSGKSTFMKILGGDLEPTLGNVSL
DPNERIGKLRQDQFAFEEFSVLDTVIMGHGELWEVKQERDRIYSLAEMSEEDGYKVADLE
VLYGEMDGYSAEARAGELLLGVGIPVEQHYGPMSEVAPGWKLRVLLAQALFSNPDILLLD
EPTNNLDIDTIRWLEQTLNDRDSTMIIISHDRHFLNMVCTHMADLDYGELRVYPGNYDEY
MTAATQARERLLADNAKKKAQIADLQSFVSRFSANASKSRQATSRARQIDKIKLDEVKAS
SRQNPFIRFEQDKKLFRNALEVEALAKGFDNGPLFKNFNLLLEVGEKIAILGANGVGKST
MLKTLVGDLMPDNGTVKWSENAQIGYYAQDHEYEFENDLTVFEWMSQWKQESDDEQAVRS
ILGRLLFSQDDIKKPAKVLSGGEKGRMLFGKLMMQKPNILVMDEPTNHLDMESIESLNMA
LEMYQGTLIFVSHDREFVSSLATRVIEITPERVVDFTGNYEDYLRTKGIE