Protein Info for BWI76_RS09005 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator MntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF01325: Fe_dep_repress" amino acids 38 to 91 (54 residues), 36.3 bits, see alignment E=7.7e-13 PF02742: Fe_dep_repr_C" amino acids 95 to 146 (52 residues), 48.9 bits, see alignment E=8.1e-17

Best Hits

Swiss-Prot: 86% identical to MNTR_SALTI: Transcriptional regulator MntR (mntR) from Salmonella typhi

KEGG orthology group: K11924, DtxR family transcriptional regulator, manganese transport regulator (inferred from 96% identity to kpe:KPK_3723)

Predicted SEED Role

"Mn-dependent transcriptional regulator MntR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B155 at UniProt or InterPro

Protein Sequence (157 amino acids)

>BWI76_RS09005 transcriptional regulator MntR (Klebsiella michiganensis M5al)
MNRRAGKPITKKVTQLVNVEEHVEGFRQVREAHRRELIDDYVELISDLIMEVGEARQVDM
AARLGVSQPTVAKMLKRLASVGLIEQIPWRGIFLTPEGEKLAHESRERHQIVENFLLVIG
VSPEIARRDAEGMEHHVSEETLAMFKQFTLKQGSLGE