Protein Info for BWI76_RS08975 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 27 to 244 (218 residues), 149 bits, see alignment E=6.6e-48 PF10613: Lig_chan-Glu_bd" amino acids 40 to 118 (79 residues), 42.8 bits, see alignment E=5.2e-15

Best Hits

Swiss-Prot: 95% identical to GLNH_ECOLI: Glutamine-binding periplasmic protein (glnH) from Escherichia coli (strain K12)

KEGG orthology group: K10036, glutamine transport system substrate-binding protein (inferred from 98% identity to kpu:KP1_1797)

MetaCyc: 95% identical to L-glutamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B147 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BWI76_RS08975 amino acid ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MKSVFKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKE
LKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAIDFSDGYYKSGLLVMVNANN
NDIKDVKDLNGKVVAVKGGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTGRADAVLHDT
PNILYFIKTAGNGKFKAVGDSLEAQNYGIAFPKGSDELREKVNGALKTLRENGTYNEIYK
KWFGTEPK