Protein Info for BWI76_RS08855 in Klebsiella michiganensis M5al

Annotation: endonuclease/exonuclease/phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF03372: Exo_endo_phos" amino acids 29 to 240 (212 residues), 81.8 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 82% identical to YBHP_ECO57: Uncharacterized protein YbhP (ybhP) from Escherichia coli O157:H7

KEGG orthology group: K06896, (no description) (inferred from 93% identity to kpu:KP1_1772)

Predicted SEED Role

"Endonuclease/Exonuclease/phosphatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B179 at UniProt or InterPro

Protein Sequence (249 amino acids)

>BWI76_RS08855 endonuclease/exonuclease/phosphatase (Klebsiella michiganensis M5al)
MPRFSLNVLTINTHKGFTAFNRRFILPELREAVRSVSADIVCLQEVMGAHEIHPLHIENW
PDTTHYEFLADTMWSDYAYGRNAVYPEGHHGNAVLSRFPIEHYQNLDVSVGNSEKRGLLY
CRIVPPESGIAIHLFCVHLGLRAHQRQAQLTMLAEWVNGLPAGEPVVVAGDFNDWRQQAN
RQLKAQAGLEEIFTRARGRPARTFPVSFPLLRLDRIYVKNAHASQPKTLALKQWRHLSDH
APLSVEIHL