Protein Info for BWI76_RS08735 in Klebsiella michiganensis M5al

Updated annotation (from data): Urocanate hydratase (EC 4.2.1.49)
Rationale: Specifically important for utilizing L-Histidine. Automated validation from mutant phenotype: the predicted function (UROCANATE-HYDRATASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: urocanate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 TIGR01228: urocanate hydratase" amino acids 10 to 553 (544 residues), 997.8 bits, see alignment E=6.4e-305 PF17391: Urocanase_N" amino acids 11 to 137 (127 residues), 207.2 bits, see alignment E=9.1e-66 PF01175: Urocanase" amino acids 140 to 348 (209 residues), 295.5 bits, see alignment E=3.4e-92 PF17392: Urocanase_C" amino acids 351 to 545 (195 residues), 308.6 bits, see alignment E=2.1e-96

Best Hits

Swiss-Prot: 97% identical to HUTU_KLEP3: Urocanate hydratase (hutU) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_14420)

MetaCyc: 85% identical to urocanase subunit (Pseudomonas putida)
Urocanate hydratase. [EC: 4.2.1.49]

Predicted SEED Role

"Urocanate hydratase (EC 4.2.1.49)" in subsystem Histidine Degradation (EC 4.2.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B165 at UniProt or InterPro

Protein Sequence (562 amino acids)

>BWI76_RS08735 Urocanate hydratase (EC 4.2.1.49) (Klebsiella michiganensis M5al)
MSQSKYRQQDVRAPRGTTLNAKSWLTEAPLRMLMNNLDPDVAENPHELVVYGGIGRAARN
WECYDAIVKALKNLESDETLLVQSGKPVGVFKTHENSPRVLIANSNLVPHWATWEHFNEL
DAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYQGSLKGRWVLTAGLGGMGGA
QPLAATLAGACSLNIECQQSRIDFRLRTRYVDEQATSLDDALARIKKYTAEGRAISIALC
GNAADIVPEMVKRGVRPDMVTDQTSAHDPLHGYLPKGWNWEEYQAKAESDPRGTILAAKR
SMADHVQAMLAFHDMGVPTFDYGNNIRQMAQEMGVDNAFAFPGFVPAYIRPLFCRGIGPF
RWVALSGDPQDIYKTDAKVKEIVKDDKHLHHWLDMARERISFQGLPARICWVGLEWRQKL
GLAFNEMVRSGELSAPIVIGRDHLDSGSVASPNRETEAMRDGSDAVSDWPLLNALLNTAS
GATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAARIARVLHNDPATGVMRHADAGYDIA
IECATEQGLNLPMVAATQGHAK