Protein Info for BWI76_RS08720 in Klebsiella michiganensis M5al

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01224: imidazolonepropionase" amino acids 32 to 404 (373 residues), 465.4 bits, see alignment E=6e-144 PF01979: Amidohydro_1" amino acids 64 to 383 (320 residues), 55.1 bits, see alignment E=7.5e-19 PF07969: Amidohydro_3" amino acids 113 to 381 (269 residues), 35.9 bits, see alignment E=6.6e-13

Best Hits

Swiss-Prot: 87% identical to HUTI_KLEP3: Imidazolonepropionase (hutI) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 87% identity to kpe:KPK_3781)

MetaCyc: 58% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Y8 at UniProt or InterPro

Protein Sequence (405 amino acids)

>BWI76_RS08720 imidazolonepropionase (Klebsiella michiganensis M5al)
MTHTLSERVIWRNARLATLDPRSSQPYGLLDHHALLVRNGRIEAIVPEGEAPAGQSIDLG
GRLLTPGLIDCHTHLVFGGSRAQEWEQRLNGVSYQTISANGGGINATVRATRDSSEAELL
ALARQRLARLLREGVTTLEIKSGYGLDLANERKMLRVVQQLAATHAVEVSPTLLSAHATP
PEYKGDPDGYINLVCETILPTLWEEGLFESVDAFCENVGFSPTQTERIYSTAQALGIPVK
GHVEQLSSLGGAELVSRYHGLSADHIEYLTPEGVAAMSRSGTVAVLLPGAFYFLNETRRP
PVELLREYQVPMAVATDYNPGTSPFASLHLAMNMACVKFGLTPEEAWAGVTRHAAQALGR
QASHGQLAPGFVADFAIWDAEHPVEMVYEPGRSPLWQRVVRGEIV