Protein Info for BWI76_RS08660 in Klebsiella michiganensis M5al
Annotation: pyridoxal phosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to YBHA_ECOLI: Pyridoxal phosphate phosphatase YbhA (ybhA) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 91% identity to eae:EAE_14335)MetaCyc: 78% identical to pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Fructose-bisphosphatase. [EC: 3.1.3.74, 3.1.3.11]
Predicted SEED Role
"Putative phosphatase"
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- superpathway of hexitol degradation (bacteria) (18/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- superpathway of anaerobic sucrose degradation (18/19 steps found)
- gluconeogenesis I (13/13 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- ginkgotoxin biosynthesis (1/3 steps found)
- oxygenic photosynthesis (11/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of phenylpropanoids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
- Vitamin B6 metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.11
Use Curated BLAST to search for 3.1.3.11 or 3.1.3.74
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B122 at UniProt or InterPro
Protein Sequence (272 amino acids)
>BWI76_RS08660 pyridoxal phosphatase (Klebsiella michiganensis M5al) MTSRVIALDLDGTLLTGKKTILPASLDALARAKDAGYQIIVVTGRHHVAIHPFYQALALD TPAICCNGTYLYDYHAKKVLESDPMPVDKALSLTEMLNEHAIHGLMYVDDAMLYEQPTGH VIRTANWAQSLPVEQRPVFTQVDSLAQAAREVKAVWKFALTDEDTAKLQRFAQHVGQTLG LECEWSWHDQVDIAREGNSKGKRLAQWVASQGLSMQDVIAFGDNYNDLSMLEAAGTGVAM GNAVEDVKARANVVIGENETTSIADYIYRHLL