Protein Info for BWI76_RS08655 in Klebsiella michiganensis M5al

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 2 to 350 (349 residues), 515.9 bits, see alignment E=6e-159 PF00005: ABC_tran" amino acids 18 to 157 (140 residues), 118.7 bits, see alignment E=3.1e-38 TIGR00638: molybdenum-pterin binding domain" amino acids 288 to 351 (64 residues), 60.5 bits, see alignment E=1.3e-20 PF03459: TOBE" amino acids 290 to 350 (61 residues), 55.1 bits, see alignment E=7.3e-19

Best Hits

Swiss-Prot: 81% identical to MODC_ECOUT: Molybdenum import ATP-binding protein ModC (modC) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_14330)

MetaCyc: 81% identical to molybdate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B150 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BWI76_RS08655 molybdenum ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MLELDFSQTLGTHCLQIRETLPASGITAVFGVSGAGKTSLINAISGLTRPQQGRIVLNGR
VLNDVEKRICLAPERRRIGYVFQDARLFPHYKVRGNLQYGMAKNMAAQFDKLVALLGIAP
LLDRLPGGLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLAREINI
PMLYVSHSLDEIQHLADNVLVLEAGKVKAFGCLEEVWSSSVMHPWLPQDQQSTILNVTVA
AQHPRYAMTALALGDRQIWVNRLDRPQGESARIRIQASDVSLVLQPAQQTSIRNILPAQV
MQCIESHGQVEVRLEISGRTLWARISPWARDELGVVPGQRLYAQIKSVSIAA