Protein Info for BWI76_RS08530 in Klebsiella michiganensis M5al

Annotation: protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details TIGR02794: protein TolA" amino acids 12 to 246 (235 residues), 145.1 bits, see alignment E=1.7e-46 amino acids 210 to 444 (235 residues), 141.6 bits, see alignment E=1.9e-45 PF06519: TolA" amino acids 349 to 442 (94 residues), 105.9 bits, see alignment E=1.1e-34 PF13103: TonB_2" amino acids 361 to 429 (69 residues), 22.2 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 56% identical to TOLA_ECOLI: Tol-Pal system protein TolA (tolA) from Escherichia coli (strain K12)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 82% identity to kpe:KPK_3827)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>BWI76_RS08530 protein TolA (Klebsiella michiganensis M5al)
MSKATEQNDKLKRAIIVSVALHIVLIALLIWSSFDEHLDASAGGGGGSSIDAVMVDPGAV
VKNYDRQQQQQASARRAAEQREKQAQQQAEELREKQAAEQERLKQLEQDRLQAQEAAKEA
KEQQKQAEEAAAKAAAAAKAKADAQAKEAQEAAAKAAADAKAKADAQAKAAEAAAAKAAA
DAKKQAEAEAAKAAADAQKKAEADAAKKAQQEAEKKAQQQAEKKAQQEAAKQAAAEKAAA
EKAAEKAAEKAAAQKAAAEKAAADKAAAAEKAAAEKAAAAKAAAAEKAAADKAAKAAAAK
AAAAKKAAAAKEANGVDDLLGDLSSGKNAPKGNTSGSAGGSSPAKGSKQGQGGASQAEIN
SYISQVQAAIKGHLYDWDTYKGKTCTLRVNLAQDGTLLSVKSEGGDPAFCQQMLAATSRM
TKFPKPPSQAVYETFKNAPLDFKPQ