Protein Info for BWI76_RS08400 in Klebsiella michiganensis M5al
Annotation: succinate dehydrogenase cytochrome b556 small membrane subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 90% identical to DHSD_SHIFL: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Shigella flexneri
KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 96% identity to kpn:KPN_00729)MetaCyc: 90% identical to succinate:quinone oxidoreductase, membrane protein SdhD (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B0X9 at UniProt or InterPro
Protein Sequence (115 amino acids)
>BWI76_RS08400 succinate dehydrogenase cytochrome b556 small membrane subunit (Klebsiella michiganensis M5al) MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFSSAFTKVF TLLALVSILIHAWIGMWQVLTDYVKPLAVRLILQLLIVVALVAYVLYGFVVVWGV