Protein Info for BWI76_RS08220 in Klebsiella michiganensis M5al

Annotation: PTS N-acetyl glucosamine transporter subunit IIABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 3 to 463 (461 residues), 698.5 bits, see alignment E=6.6e-214 PF02378: PTS_EIIC" amino acids 12 to 300 (289 residues), 247.5 bits, see alignment E=2.7e-77 TIGR00826: PTS system, glucose-like IIB component" amino acids 360 to 452 (93 residues), 91.5 bits, see alignment E=5e-30 PF00367: PTS_EIIB" amino acids 395 to 427 (33 residues), 48.8 bits, see alignment (E = 5.4e-17) PF00358: PTS_EIIA_1" amino acids 501 to 626 (126 residues), 159.6 bits, see alignment E=4.5e-51 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 502 to 622 (121 residues), 160.5 bits, see alignment E=2.5e-51

Best Hits

Swiss-Prot: 92% identical to PTW3C_KLEPN: PTS system N-acetylglucosamine-specific EIICBA component (nagE) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 94% identity to eae:EAE_13995)

MetaCyc: 90% identical to N-acetylglucosamine-specific PTS enzyme IIABC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-167 [EC: 2.7.1.193]; TRANS-RXN-167A [EC: 2.7.1.193, 2.7.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.191 or 2.7.1.193

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0U7 at UniProt or InterPro

Protein Sequence (650 amino acids)

>BWI76_RS08220 PTS N-acetyl glucosamine transporter subunit IIABC (Klebsiella michiganensis M5al)
MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNISFIAQAGGAIFDNLALIFAIGV
ASSWSKDSAGAAALAGAVGYFVLTKAMVTINPAINMGVLAGIITGLVGGAVYNRWSGIKL
PDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQNAIHAGGEWIVGAGALGSGIFGFI
NRLLIPTGLHQVLNTIAWFQIGEFTNAAGAVFHGDINRFYAGDGTAGMFMSGFFPIMMFG
LPGAALAMYFAAPKERRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYLLHAILTG
ISLFVATALGIHAGFSFSAGAIDYVLMYSLPAASKNVWMLIVMGVVFFVIYFLLFSAVIR
MFNLKTPGREDKVDDVVTEEANSNTEEGLTQLATNYIAAVGGTDNLKAIDACITRLRLTV
ADSALVNDAACKRLGASGVVKLNKQTIQVIVGAKAESVGDEMKKVVARGPVAAAAAASHS
APVAAQAVKPQAVANAKTVEALVSPITGDIVALEQVPDEAFASKAVGDGVAVKPTDKIVV
APAAGTVVKIFNTNHAFCLETENGAEIVVHMGIDTVALNGQGFKRLVEEGAEVKAGEPIL
ELDLEFLNANARSMISPVVCSNSDDYSALVIQATGKVVAGQTPLYEIKGK