Protein Info for BWI76_RS08070 in Klebsiella michiganensis M5al

Annotation: LPS assembly lipoprotein LptE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04390: LptE" amino acids 34 to 159 (126 residues), 70.4 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 78% identical to LPTE_SALHS: LPS-assembly lipoprotein LptE (lptE) from Salmonella heidelberg (strain SL476)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_13890)

MetaCyc: 78% identical to LPS assembly lipoprotein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0M7 at UniProt or InterPro

Protein Sequence (196 amino acids)

>BWI76_RS08070 LPS assembly lipoprotein LptE (Klebsiella michiganensis M5al)
MRYLATLLLSLAVLITAGCGWHLRSTTQVPTAMKTMIFQSGDPNGPLSRAVRNQLRLNGV
ELVDSSTLRKDIPSLRLETSSIQKDTASIFQDGRTAEYQMVMTVNASVLIPGHDIYPITT
KVYRSFFDNPQAALAKDAEQDMIVQEMYDKAAEQLIRKLPSVHVADVEATKEDEKPVATT
PAASTSGNRVSTTLGN