Protein Info for BWI76_RS08060 in Klebsiella michiganensis M5al

Annotation: nicotinic acid mononucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR00125: cytidyltransferase-like domain" amino acids 9 to 71 (63 residues), 43.3 bits, see alignment E=3.3e-15 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 10 to 215 (206 residues), 189.4 bits, see alignment E=7e-60 PF01467: CTP_transf_like" amino acids 10 to 190 (181 residues), 106.9 bits, see alignment E=4.7e-35

Best Hits

Swiss-Prot: 84% identical to NADD_KLEP7: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 84% identity to kva:Kvar_3695)

MetaCyc: 76% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0T4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>BWI76_RS08060 nicotinic acid mononucleotide adenylyltransferase (Klebsiella michiganensis M5al)
MVDMTQLQAMYGGTFDPVHYGHLKPVEILANLIGLNKVTIVPNNVPPHRPQPEATSDQRR
HMLALAIADKPLFILDDRELKRDTPSYSAQTLREWRQEQGPQRPLAFIIGQDSLLTFTTW
HEYESILDNVHLIVCRRPGYPLTMACEQDQQWLDKHLTHDVERLHSSPAGVIYLAETPRF
DISATLIRQRLEAGEPCADMLPETVLDYIHEQKLYC