Protein Info for BWI76_RS07995 in Klebsiella michiganensis M5al

Annotation: twin-arginine translocase subunit TatA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02416: TatA_B_E
  • amino acids 4 to 53 (50 residues), 51.5 bits, E=2.3e-18
• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 4 to 48 (45 residues), 70.9 bits, E=2.5e-24

Best Hits

Swiss-Prot: 94% identical to TATE_KLEP7: Probable Sec-independent protein translocase protein TatE (tatE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03425, sec-independent protein translocase protein TatE (inferred from 94% identity to kpn:KPN_00659)

MetaCyc: 78% identical to twin arginine protein translocation system - TatE protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatE" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

See A0A285B0Q0 at UniProt or InterPro

Protein Sequence (67 amino acids)

>BWI76_RS07995 twin-arginine translocase subunit TatA (Klebsiella michiganensis M5al)
MGEISITKLLVVAALIILVFGTKKLRTLGGDLGSAIKGFKKAMSDDDDSAKKTSAEEAPA
QKLSHKE