Protein Info for BWI76_RS07900 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 35 to 294 (260 residues), 147.6 bits, see alignment E=5.1e-47 PF00532: Peripla_BP_1" amino acids 42 to 244 (203 residues), 42.4 bits, see alignment E=6.1e-15

Best Hits

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 95% identity to kpe:KPK_3934)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Q3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>BWI76_RS07900 sugar ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MSQKMKLLPIALGLLSLASVNALAAEALSLQGKTIGVAVVGTQHFWDREAYKGATEEVEK
LGGKAIGVDGGRDNQVHANNHDILLSRKVDAVISILGDSAVEPKFKALRDAGIPVFTVDH
VSKYSVNNTTSDNYTLGSTIGRYMADELGGKGNVAVFNAFSSSLRICGIRYDQWKYVLKD
YPDIHIIQPELAEQFANSPEDARKKTLELLSQYPKGKLDAIHVACWDQPAIGIVQALEET
GRDKDVKVTAIDAGPETLEIMAEPGSPFVANVAQQPHLIGQTSADNVARYFDKQKLPLQT
FIPVVPVKGPQEAKAVYKQLGYGELQ