Protein Info for BWI76_RS07865 in Klebsiella michiganensis M5al

Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 8 to 194 (187 residues), 136.1 bits, E=6.4e-44
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 9 to 199 (191 residues), 219 bits, E=2.1e-69

Best Hits

Swiss-Prot: 96% identical to MTNB_KLEP3: Methylthioribulose-1-phosphate dehydratase (mtnB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 94% identity to kpu:KP1_1585)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Sequence Analysis Tools

See A0A285B0N5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>BWI76_RS07865 methylthioribulose 1-phosphate dehydratase (Klebsiella michiganensis M5al)
MWQERLAQLVTTCHWIGAKGWAPATGGNMSVRQDETWCWLSESGRDKGSLTTEDFLQVEI
ASNTAPSGRKPSAETGLHTLVYRLFPEANVVLHVHTVNATVLSRIEKGATLALQGYEMQK
TLTGQHSHLDTVPVAIFDNDQDIDALAARIEDYAQTHPLRYGFLLRGHGLTCWGKDINEA
RRQLEGLEFLFECELMRRRYERD