Protein Info for BWI76_RS07855 in Klebsiella michiganensis M5al

Annotation: PucR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF07905: PucR" amino acids 7 to 126 (120 residues), 99.4 bits, see alignment E=3.5e-32 PF17853: GGDEF_2" amino acids 152 to 288 (137 residues), 42.3 bits, see alignment E=1.6e-14 PF13556: HTH_30" amino acids 341 to 399 (59 residues), 69.9 bits, see alignment E=2.6e-23 PF02954: HTH_8" amino acids 346 to 375 (30 residues), 29.5 bits, see alignment (E = 9.9e-11)

Best Hits

KEGG orthology group: None (inferred from 88% identity to kva:Kvar_3735)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0P3 at UniProt or InterPro

Protein Sequence (411 amino acids)

>BWI76_RS07855 PucR family transcriptional regulator (Klebsiella michiganensis M5al)
MSLTVGEILALEGLSAMRLRAGKQGLQLAVRWYYVAENENIAEWIMGGELVFITGINHPR
DEDNLIHLLMEGKQRGIAGMVILTGDVFIQAIPPRLIALADALGIPLIEQPYLLKMVIVT
ERIGTALVRSENALQSQRDILLQLLTGDYPDLQILHQRALHQQLDFTRPLRVAALRLEGI
PRLFRQFPPEQAEAWLQQARRTVRQRLQQQLNQQGNPYPLVERSNMFLFLLPDEDGEFYQ
QKTWLQAWLIALAESEDGLSLLCGLSAPVQQLQGYQRALSQARQALDLSDNLRPAQRISD
YQQLGFIKLLSAVSDPALLSDFMHDTLGCLIEPDRKSPWLLLETLETLLQESGNVVRAAE
RLGIHRNTLHQRIQRIEKLTGYPVSHPQFHLNASVALAIWRMSQNHLREQP