Protein Info for BWI76_RS07820 in Klebsiella michiganensis M5al

Annotation: S-methyl-5-thioribose kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to MTNK_KLEP7: Methylthioribose kinase (mtnK) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00899, 5-methylthioribose kinase [EC: 2.7.1.100] (inferred from 90% identity to kva:Kvar_3742)

MetaCyc: 90% identical to S-methyl-5-thioribose kinase (Klebsiella pneumoniae)
S-methyl-5-thioribose kinase. [EC: 2.7.1.100]

Predicted SEED Role

"5-methylthioribose kinase (EC 2.7.1.100)" in subsystem Methionine Salvage (EC 2.7.1.100)

MetaCyc Pathways

L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
L-methionine salvage cycle II (plants) (9/11 steps found)
S-methyl-5'-thioadenosine degradation I (2/2 steps found)
5'-deoxyadenosine degradation II (3/4 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0M5 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BWI76_RS07820 S-methyl-5-thioribose kinase (Klebsiella michiganensis M5al)
MSQYHTFTASDAVAYAQQFGGIENPSELVSAQEVGDGNLNLVFKIFDTEGVSRIIVKQAL
PYVRCVGESWPLTLDRARLEAQTLVAHYQHCPQHTVQIVHFDPELAVMVMEDLSDHRIWR
GELINNVYYPRAAGQLGEYLAQALFHTSDFYLHPHEKKAQVAQFINPEMCEITEDLFFND
PYQVHERNSYPAALEADVAALRDDTQLKLAVAALKHRFFSHAEALLHGDIHSGSIFVAEG
SFKAIDAEFGFFGPIGFDIGTAIGNLLLNYCGLPGHLGIRDAAAAREQRLSDIQQFWTTF
AERFQALAAEKSRDAALAWPGYASAFLKKVWADAVGFCGTELIRRSVGLSHVADIDTIQD
EAMRHECLRHAITLGKALILIADRLDNVEELIARIRQYG