Protein Info for BWI76_RS07745 in Klebsiella michiganensis M5al

Annotation: isochorismate synthase EntC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00543: isochorismate synthase" amino acids 110 to 387 (278 residues), 272 bits, see alignment E=4e-85 PF00425: Chorismate_bind" amino acids 126 to 380 (255 residues), 227 bits, see alignment E=1.5e-71

Best Hits

Swiss-Prot: 76% identical to ENTC_ECO57: Isochorismate synthase EntC (entC) from Escherichia coli O157:H7

KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 86% identity to kpn:KPN_00611)

MetaCyc: 76% identical to isochorismate synthase EntC (Escherichia coli K-12 substr. MG1655)
Isochorismate synthase. [EC: 5.4.4.2]

Predicted SEED Role

"Isochorismate synthase (EC 5.4.4.2) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 5.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.4.2

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0F6 at UniProt or InterPro

Protein Sequence (391 amino acids)

>BWI76_RS07745 isochorismate synthase EntC (Klebsiella michiganensis M5al)
METSLAEEVREKKMTLPPESFFFMSPYRSFTTAGCFSRFSHPAADGDDPDGEFQQKMAAA
FKAARTAGIARPVMVGAIPFDTSEPSELFIPASWTAFSRTEKQHSARYASGQNPMDVVQR
REIPEQDTFMAMVARAAALTATPEVDKVVLSRLIDITTRERVDSGALLERLIAQNPASFN
FHVPLSDGGVLLGASPELLLRKEGAHFSSLPLAGSARRQPDDVLDREAGHRLLASEKDRH
EHELVTQAMKAVLAPRSSELSLPDSPQLITTPTLWHLATQIQGTALANENAMSLACLLHP
TPALSGFPHQAAKRLIGELEPFDRQLFGGIVGWCDDEGNGEWVVTIRCARLQQSTLRLFA
GAGIVPASSPLGEWRETGVKLTTMLNVFGLQ