Protein Info for BWI76_RS07735 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details PF05977: MFS_3" amino acids 16 to 403 (388 residues), 71.7 bits, see alignment E=4.7e-24 PF07690: MFS_1" amino acids 22 to 239 (218 residues), 68.8 bits, see alignment E=4.2e-23 amino acids 239 to 400 (162 residues), 33.7 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 84% identical to ENTS_CITK8: Enterobactin exporter EntS (entS) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K08225, MFS transporter, ENTS family, enterobactin (siderophore) exporter (inferred from 92% identity to kpe:KPK_3969)

MetaCyc: 83% identical to enterobactin exporter EntS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-496

Predicted SEED Role

"Enterobactin exporter EntS" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0M6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>BWI76_RS07735 MFS transporter (Klebsiella michiganensis M5al)
MNRQSWLLNLSLLKTHPAFRAVFIARFISILSLGLLGVAIPVQIQMMTHSTWQVGLSVTL
TGASMFVGLMIGGVLADRYERKRLILLARGTCGIGFVGLCLNAMLPEPSLIAIYLLGIWD
GLFASIGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISPMIGGLLLATGGVAWNYG
LAAAGTFITTLTLLRLPLLAPPPQPREHPLKSLNAGLKFLFNSPLIGGIALLGGLLTMAS
AVRVLYPALAGSWQMSASQIGLLYAAIPLGAAFGALTSGQLAQTAKPGVLMLATTVGSFV
AIALFSLMPVWELGALCLALFGWLSAISSLLQYTLIQTQTPENMLGRINGLWTAQNVTGD
AIGAALLGGLGAILTPVASASASGWALVIVGAVLVGLLRELRRFQRPEAVSES