Protein Info for BWI76_RS07730 in Klebsiella michiganensis M5al

Annotation: iron-enterobactin transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details PF01032: FecCD" amino acids 20 to 328 (309 residues), 312.5 bits, see alignment E=1.4e-97

Best Hits

Swiss-Prot: 88% identical to FEPD_ECOLI: Ferric enterobactin transport system permease protein FepD (fepD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_13630)

MetaCyc: 88% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepD (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0J7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BWI76_RS07730 iron-enterobactin transporter membrane protein (Klebsiella michiganensis M5al)
MSCSTTAARAFAVPGLLIVLIIAVALSLLIGAKPLPFSVVLDAFTGTCQSADCTIVLDAR
LPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNSGASFAIVLGAALFGLSSPQEQ
LLMAFCGAFGASLLVAFTGSQGGGQLSPVRLTLAGVALAAVLEGLSSGIALLNPDVYDQL
RFWQAGSLDVRTLQTLKIVLIPVLIAGLVTLLLSRALNSLSLGNDTATALGSRVARTQLI
GLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWSLPVTLLATPALLLFADVLG
RLLVPGELRVSVVSAFIGAPVLIWLVRRQPRGGGM