Protein Info for BWI76_RS07720 in Klebsiella michiganensis M5al

Annotation: iron-enterobactin transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF01078: Mg_chelatase" amino acids 17 to 79 (63 residues), 21.2 bits, see alignment E=2.6e-08 PF00005: ABC_tran" amino acids 25 to 172 (148 residues), 120.2 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 89% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_13620)

MetaCyc: 89% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport ATP-binding protein FepC (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0K4 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BWI76_RS07720 iron-enterobactin transporter ATP-binding protein (Klebsiella michiganensis M5al)
MTAVTSRLRGDQLTLAYGKKTIAESLNVTIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPA
SGHVYLDGEQIQRYASKEVAKRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKED
EEAVSRAMKATGITDLARQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQI
DLLELLSELNQQKGYTLAAVLHDLNQACRYATHLIALREGKIVAEGAPKEIVSAELIEKI
YGLRCTIIEDPVAHTPLVVPLGRR