Protein Info for BWI76_RS07690 in Klebsiella michiganensis M5al

Annotation: enterochelin synthetase component D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF17837: 4PPT_N" amino acids 38 to 100 (63 residues), 61.4 bits, see alignment E=7.2e-21 PF01648: ACPS" amino acids 103 to 205 (103 residues), 55.3 bits, see alignment E=6.5e-19

Best Hits

Swiss-Prot: 59% identical to ENTD_SHIFL: Enterobactin synthase component D (entD) from Shigella flexneri

KEGG orthology group: K02362, enterobactin synthetase component D [EC: 2.7.8.-] (inferred from 64% identity to kpe:KPK_3977)

MetaCyc: 58% identical to phosphopantetheinyl transferase EntD (Escherichia coli K-12 substr. MG1655)
2,3-dihydroxybenzoate--serine ligase. [EC: 6.3.2.14]; Holo-[acyl-carrier-protein] synthase. [EC: 6.3.2.14, 2.7.8.7]; 2.7.8.7 [EC: 6.3.2.14, 2.7.8.7]

Predicted SEED Role

"4'-phosphopantetheinyl transferase (EC 2.7.8.-) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.7

Use Curated BLAST to search for 2.7.8.- or 2.7.8.7 or 6.3.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0I9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>BWI76_RS07690 enterochelin synthetase component D (Klebsiella michiganensis M5al)
MHIQHSIIQLAGHSLQRVDFDPLTFQPEDLLWLPHHARLSGCVRKRQSEHLAGRIAAVYA
LREVGEKGVPAIGDQRQPLWPAPWYGSISHSERSALAVVSARPVGVDIERVMAPSLAAEL
ESSIINSAEKKRLDASGLPPELALTLAFSAKESAFKASHSAIQARMGFSDFEVTYIKEEN
LRLRLSAGEYRLQWIKAGEYVITICAP