Protein Info for BWI76_RS07665 in Klebsiella michiganensis M5al

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 26 to 279 (254 residues), 67.4 bits, see alignment E=1.5e-22 PF13407: Peripla_BP_4" amino acids 28 to 282 (255 residues), 176.4 bits, see alignment E=8.6e-56

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 97% identity to kpu:KP1_1541)

MetaCyc: 44% identical to putative erythritol ABC transporter substrate-binding protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0E9 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS07665 ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MKLRLTLLTAATLTAFSFAAQAAEKGTIMIMVNSLDNPYYASEAKGASEKAKELGYQTTI
LSHGEDVKKQNELIDTAIGKKVQGIILDNADSTASVAAIEKAKKAGIPVVLINREIPVDD
IALEQITHNNFQAGSEVANVFVEKMAEKGKYAELTCNLADNNCVTRSKSFHQVIDQYPDM
VSVAKQDAKGTLIDGKRIMDSILQAHPDVKGVICGNGPVALGAIAALKAANRNDVVVVGI
DGSNDERDAVKAGTLQATVMLQAQAIAAQGVTDLDNYLQKGEKPAKQRVMFRGILITQDN
ADKVQDFNIKS