Protein Info for BWI76_RS07620 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator BetI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR03384: transcriptional repressor BetI" amino acids 2 to 191 (190 residues), 260.9 bits, see alignment E=3.2e-82 PF00440: TetR_N" amino acids 14 to 59 (46 residues), 52.8 bits, see alignment 2.8e-18 PF13977: TetR_C_6" amino acids 84 to 192 (109 residues), 111.7 bits, see alignment E=2.4e-36

Best Hits

Swiss-Prot: 86% identical to BETI_KLEP3: HTH-type transcriptional regulator BetI (betI) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_13525)

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0K5 at UniProt or InterPro

Protein Sequence (197 amino acids)

>BWI76_RS07620 transcriptional regulator BetI (Klebsiella michiganensis M5al)
MPKLGMQPIRQRQLIDATLAAINEVGMHDATVAQIARRAGVSTGIISHYFKDKNGLLEAT
MRDITGQLRQAVLSRLHALPDAGPRERLRAIVAGNFDDSQISSAAMKAWLAFWASSMHQP
MLYRLQQVSSRRLLSNIVYEFQRALPREEAQEAGYGLAALIDGLWLRAALSGKPLDKARA
ETLAEHFISQYLPPTSQ