Protein Info for BWI76_RS07595 in Klebsiella michiganensis M5al

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 5 to 192 (188 residues), 169 bits, see alignment E=1.8e-53 PF08659: KR" amino acids 7 to 166 (160 residues), 58.4 bits, see alignment E=1.8e-19 PF13561: adh_short_C2" amino acids 11 to 198 (188 residues), 119.3 bits, see alignment E=4.1e-38

Best Hits

Swiss-Prot: 100% identical to ISFD_KLEOX: Sulfoacetaldehyde reductase (isfD) from Klebsiella oxytoca

KEGG orthology group: K05886, serine 3-dehydrogenase [EC: 1.1.1.276] (inferred from 92% identity to kpe:KPK_4008)

MetaCyc: 100% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.276 or 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0C6 at UniProt or InterPro

Protein Sequence (254 amino acids)

>BWI76_RS07595 putative oxidoreductase (Klebsiella michiganensis M5al)
MATSKVVFITGATSGFGEAAAQVFADAGWSLVLSGRRFERLKTLQDKLASQVPVHIIELD
VRDSDAVAAAVAALPADFADITTLINNAGLALSPQPAQKVDLDDWKTMIDTNVTGLVNVT
HALLPTLINHGAGASIINIGSIAGQWPYPGSHVYGASKAFVKQFSYNLRCDLLGTGVRVT
DLAPGIAETEFTLVRTKGDQAASDNLYRGTTPLSARDIAEQMFYIATLPDHMNINRVEVM
PVRQAWQPFAIDRD