Protein Info for BWI76_RS07525 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 75 (75 residues), 26.8 bits, see alignment E=5.2e-10 PF00528: BPD_transp_1" amino acids 113 to 316 (204 residues), 138.9 bits, see alignment E=1.6e-44

Best Hits

Swiss-Prot: 38% identical to Y1031_BRUAB: Putative peptide transport system permease protein BruAb2_1031 (BruAb2_1031) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 96% identity to kva:Kvar_3809)

MetaCyc: 31% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0F7 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS07525 ABC transporter permease (Klebsiella michiganensis M5al)
MINTLLYRILLAVPTMLGVAVICFMLVQIAPGDPLVSVMPPDASESLRQTLMQAYGFDKP
LPLQFVHWLWRALHGDLGMSVATGRPVIDEVMTAVTYSLRLALLATAIGFVLGSLFGFVA
GYFRNSIIDRLASVLSVFGVSVPHYWLGMLLVIVFSVKFALLPATGGGPIGEVGWQWDWE
HLQFMLLPAFTLSVIPTGIIARTVRSQVADILSQEFIVGLRARGLNESRIFLHVVKNAAP
TALAVMGLQVGYLMGGSILVETVFSWPGTGLLLNTAIFQRDLPLLQGTIWVLALFFVLLN
LLVDILQTSLDPRIKRS