Protein Info for BWI76_RS07225 in Klebsiella michiganensis M5al

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 4 to 121 (118 residues), 78 bits, see alignment E=2.6e-25 PF03807: F420_oxidored" amino acids 6 to 88 (83 residues), 24.8 bits, see alignment E=7e-09 PF22725: GFO_IDH_MocA_C3" amino acids 129 to 250 (122 residues), 76.5 bits, see alignment E=4.7e-25 PF02894: GFO_IDH_MocA_C" amino acids 134 to 330 (197 residues), 70.9 bits, see alignment E=3.5e-23

Best Hits

Swiss-Prot: 38% identical to MI2D_RHIME: Inositol 2-dehydrogenase (idhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 83% identity to kpn:KPN_00507)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0H4 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BWI76_RS07225 putative oxidoreductase (Klebsiella michiganensis M5al)
MTCIRFALLGSGFIGQVHAASLARHERTVLSMVADADPERAKALASRYGARAVTVAEAIN
SDAIDAVLIASSTPSHAALLAAAARAGKAVYCEKPIDLSLARARQVVEKVLPLGVPVTVG
FNRRFDASHQQLRREIEAGVIGKIELVQMVCRASIMPPLEYLRSSGGQMRDQAIHFFDLL
RFLTGDEVTTVAAMGDALALAEIAEFDDVDTSILMLRMRGGAMAQLDNTRRTGHGYDERI
SLLGSDGVLESGSQTTRGVTLWQGERRIQPGLYPDWFSRVEGSYYAHLDAFVRSLGGEEV
ADLPGLLDGLRAQAIAEAAVLSLQQGQFVSVEPLA