Protein Info for BWI76_RS07190 in Klebsiella michiganensis M5al

Annotation: lysine/cadaverine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 2 to 433 (432 residues), 465.9 bits, see alignment E=7.9e-144 PF13520: AA_permease_2" amino acids 7 to 419 (413 residues), 146.3 bits, see alignment E=1.3e-46 PF00324: AA_permease" amino acids 20 to 362 (343 residues), 79.6 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 91% identical to CADB_ECOLI: Probable cadaverine/lysine antiporter (cadB) from Escherichia coli (strain K12)

KEGG orthology group: K03757, cadaverine:lysine antiporter (inferred from 95% identity to kva:Kvar_3880)

MetaCyc: 91% identical to lysine:cadaverine antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-68; TRANS-RXN0-212

Predicted SEED Role

"Lysine/cadaverine antiporter membrane protein CadB" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0B8 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BWI76_RS07190 lysine/cadaverine antiporter (Klebsiella michiganensis M5al)
MSSAKKIGLFACTGVVAGNMMGSGIALLPANLASIGSIAIWGWVISIIGAMSLAYVYARL
ATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITAVSYLSTFFPILNNPVP
AGIACIAIVWIFTFVNMLGGTWVSRLTTIGLVLVLIPVVMTAVVGWHWFDVATYQANWNT
SATTDSHAVVKSILLCLWAFVGVESAAVSTGMVKNPKRTVPLATMLGTALAGIVYIAATQ
VIAGMYPASEMAASGAPFAISASTILGGWAAPMVSAFTAFACLTSLGSWMMLVGQAGVRA
ANDGNFPKIYGELDKNGNPKKGLLLAAVKMTVLMVLITLMNSTGGKASDLFGELTGIAVL
LTMLPYFYSCVDLIRFEGINVRNFVSLICSVLGCGFCFIALMGASSFELAGTFIVSLIIL
MFYGRKMHQRQSNDGSADSSTASAH