Protein Info for BWI76_RS07180 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator CadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 158 to 179 (22 residues), see Phobius details PF00486: Trans_reg_C" amino acids 24 to 100 (77 residues), 65.5 bits, see alignment E=3.6e-22 PF18500: CadC_C1" amino acids 190 to 322 (133 residues), 240.1 bits, see alignment E=7.1e-76

Best Hits

Swiss-Prot: 69% identical to CADC_ECOLI: Transcriptional activator CadC (cadC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_13240)

Predicted SEED Role

"Transcriptional activator of cad operon" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B093 at UniProt or InterPro

Protein Sequence (510 amino acids)

>BWI76_RS07180 transcriptional regulator CadC (Klebsiella michiganensis M5al)
MQQPVVRVGEWLVTPSVNQISRKGRQLTLEPRLIDLLVFFARHPGEVLSRDELIDNVWTR
NVVTSHVVTQSVSELRKSLKDGDDGSLEYIATVPKRGYKLTVPVIWCTEEGEELTPVIPA
ETPTVAVDAPSVSPQPEAAAPEMAPVVKPEKRKRLSTFIVWGLFLLALASCVALVALSTL
ESRPPVTKTRLLLNPRDVDIHLLSGSACNNWSSQHSYAIGLGSLITTSLNTFSTFMVHDK
TNYNINEPSSSGKTLTIEFVNQRHYRAQQCFMSVKVVDNADGSTMMDKRYFVTSDNQLSI
QNDLLSSLSEALKQPWPARMQEMLKQYQPSQSIALTHFYQAHQLLMNGDVDSLGKASSLL
ADVNKQSPDFTYAWAEKALVDVLRHSQQPLDDKQLADLYSEITRVGNMPGIKDMAIFYQI
KTVDMLGKGKVDEAYSAINTGIDLEMSWMNYVLLGKVYEMKGQNREAADAYLTAFNLRPG
ENTFYWIENAVFQTSVTRVVPYLDNFLASE