Protein Info for BWI76_RS07035 in Klebsiella michiganensis M5al

Annotation: Zn-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR03176: allantoate amidohydrolase" amino acids 1 to 410 (410 residues), 719.9 bits, see alignment E=7.4e-221 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 7 to 407 (401 residues), 585.8 bits, see alignment E=4.2e-180 PF04389: Peptidase_M28" amino acids 61 to 147 (87 residues), 22.6 bits, see alignment E=8e-09 PF01546: Peptidase_M20" amino acids 80 to 405 (326 residues), 89.3 bits, see alignment E=3.4e-29

Best Hits

Swiss-Prot: 81% identical to ALLC_ECOLI: Allantoate amidohydrolase (allC) from Escherichia coli (strain K12)

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 94% identity to kpu:KP1_1372)

MetaCyc: 81% identical to allantoate amidohydrolase (Escherichia coli K-12 substr. MG1655)
Allantoate deiminase. [EC: 3.5.3.9]

Predicted SEED Role

"Allantoate amidohydrolase (EC 3.5.3.9)" in subsystem Allantoin Utilization (EC 3.5.3.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.9

Use Curated BLAST to search for 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZW0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>BWI76_RS07035 Zn-dependent hydrolase (Klebsiella michiganensis M5al)
MAHYFRQAIEETLPWLSSFGADPTGGITRLLYSPEWLQAQQAFKQRMSESGLETRFDEVG
NLYGRLPGTRFPDEVILSGSHIDSVVNGGNLDGQFGALAAWLAVRWLKETYGAPLRTVEV
LALAEEEGSRFPYVFWGSKNIVGIANPADVREINDAKGVAFVDAMKQCGFTLPAAPLAPR
RDIKAFVELHIEQGRVLETNKQSIGVVNAIVGQRRYTVTLTGESNHAGTTPMGYRRDTVH
AFSRICCESIAKAKAHGDPLVLTFGKVDPQPNTVNVVPGKTVFTMDCRHTDARELTAFTE
VIEADMRRICREMEIGIEIDLWMDEAPVLMDKTLVARLTALCEKERVNFRVMHSGAGHDA
QIFAPCFPTCMIFMPSIKGISHNPAESTHIDDLAEGVKTLALMLHQLAWTE