Protein Info for BWI76_RS06760 in Klebsiella michiganensis M5al

Annotation: maltose O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF12464: Mac" amino acids 7 to 56 (50 residues), 69.6 bits, see alignment E=3.3e-23 PF14602: Hexapep_2" amino acids 92 to 108 (17 residues), 11.3 bits, see alignment (E = 3.5e-05) amino acids 129 to 162 (34 residues), 38.9 bits, see alignment 8.6e-14 PF00132: Hexapep" amino acids 130 to 162 (33 residues), 38.8 bits, see alignment 7.6e-14

Best Hits

Swiss-Prot: 79% identical to MAA_ECOLI: Maltose O-acetyltransferase (maa) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to eae:EAE_12935)

MetaCyc: 79% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZW2 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BWI76_RS06760 maltose O-acetyltransferase (Klebsiella michiganensis M5al)
MSEEKQKMIAGELYLAGDATLKADRLRARQLLHRYNHSAPEEHELRKALLSELLGHASDA
YIEPTFRCDYGYNISLGKNFYANFDCVMLDVCPIQIGDNCMLAPGVHIYTATHPLDPVDR
NSGQEYGKPVTIGHNVWIGGRAVINPGVTIGDNAVVASGSVVVKNVPANAVVGGNPARII
KMLESEKR