Protein Info for BWI76_RS06705 in Klebsiella michiganensis M5al

Annotation: binding-protein-dependent transport system inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 275 (174 residues), 71.1 bits, see alignment E=5.1e-24

Best Hits

Swiss-Prot: 66% identical to GANQ_BACSU: Putative arabinogalactan oligomer transport system permease protein GanQ (ganQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 97% identity to kpn:KPN_00429)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZV2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS06705 binding-protein-dependent transport system inner membrane protein (Klebsiella michiganensis M5al)
MAKSPSIKREKWIRLSLTWLVVIFVSTMIIYPLVWTVGASLNAGNSLLSTSIIPENLSFQ
HYADLFNGNVNYLTWYWNSMKISFMTMVLTLISVSFTAYAFSRFRFKGRQNGLMLFLLLQ
MIPQFSALIAIFVLSQLLGLINSHLALVLIYVGGMIPMNTWLMKGYLDAIPKDLDESARM
DGASSFRIFFEIIMPLSKPILAVVALFSFTGPLGDFILSSTILRTPDKYTLPIGLYNLVA
QKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGSTKG