Protein Info for BWI76_RS06675 in Klebsiella michiganensis M5al

Annotation: nickel/cobalt efflux protein RcnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF03824: NicO" amino acids 13 to 274 (262 residues), 155.9 bits, see alignment E=1.5e-49 PF13386: DsbD_2" amino acids 163 to 244 (82 residues), 26.3 bits, see alignment E=6.7e-10

Best Hits

Swiss-Prot: 61% identical to RCNA_SALTY: Nickel/cobalt efflux system RcnA (rcnA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 82% identity to kpn:KPN_00423)

MetaCyc: 61% identical to Ni2+/Co2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-584; TRANS-RXN0-585

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>BWI76_RS06675 nickel/cobalt efflux protein RcnA (Klebsiella michiganensis M5al)
MTDFASLLQQGNAWLFIPSAILLGALHGLEPGHSKTMMAAFIVAVRGTLKQAVLLGLAAT
VSHTAVVWLVAMAGLWFGRGWNAQTSEPWFQLFSGILIVLIACWMLWRTWHESRSHHHEH
EHEHEHEHNHEHHHHPHEHHPHVHQPPLVAADDWQDAHQRAHAQEINRRFNGQRVTTGQI
VLFGLTGGLIPCPASITVLLICLQLKKFSLGATLVLGFSVGLALTLVASGAIAALSLKHV
ANRWPGLNDLSRKAPWISGTLIMVVGLYMLLHGWSHL