Protein Info for BWI76_RS06665 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 38% identical to Y522_HAEIN: Uncharacterized protein HI_0522 (HI_0522) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 85% identity to kva:Kvar_3959)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZQ9 at UniProt or InterPro

Protein Sequence (204 amino acids)

>BWI76_RS06665 membrane protein (Klebsiella michiganensis M5al)
MVRRLLQLYIGLVLYGVSTALFVHANLGADPWDVFHLGIGKQFNLDFGTVMILTGAAVLL
LWIPLRQMPGLGTVSNVIVLGLAANATLAVLPPLDSLVARSLLLGGAIVLNALATGMYIG
AGFGPGPRDGLMTGLHARTGWSLRGIRTAIEVSVLLIGWMMGSKFGVGTVLYALTIGPLI
QLCLPWFHQPAARKALAKPGEAIS