Protein Info for BWI76_RS06635 in Klebsiella michiganensis M5al

Annotation: methylated-DNA--protein-cysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 6 to 75 (70 residues), 51.5 bits, see alignment E=4.2e-18 PF01035: DNA_binding_1" amino acids 7 to 86 (80 residues), 93.2 bits, see alignment E=3.6e-31

Best Hits

Swiss-Prot: 52% identical to ATL_VIBPQ: DNA base-flipping protein (A79_1377) from Vibrio parahaemolyticus serotype O3:K6 (strain AQ3810)

KEGG orthology group: K07443, methylated-DNA-protein-cysteine methyltransferase related protein (inferred from 95% identity to kpe:KPK_4264)

Predicted SEED Role

"methylated-DNA--protein-cysteine methyltransferase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZQ4 at UniProt or InterPro

Protein Sequence (103 amino acids)

>BWI76_RS06635 methylated-DNA--protein-cysteine methyltransferase (Klebsiella michiganensis M5al)
MDSHDTFPQRVWQIVASIPEGYVATYGDVAQLAGSPRAARQVGGVLKRLPEGSQLPWHRV
VNRHGDISLTGPDLQRQRQALLAEGVQVSGSGHIDLQHYRWIY