Protein Info for BWI76_RS06335 in Klebsiella michiganensis M5al

Annotation: nucleoside-specific channel-forming protein Tsx

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03502: Channel_Tsx" amino acids 32 to 294 (263 residues), 290.5 bits, see alignment E=6.2e-91

Best Hits

Swiss-Prot: 93% identical to TSX_KLEPN: Nucleoside-specific channel-forming protein Tsx (tsx) from Klebsiella pneumoniae

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 94% identity to kva:Kvar_4018)

MetaCyc: 89% identical to nucleoside-specific channel-forming protein Tsx (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-468

Predicted SEED Role

"Nucleoside-specific channel-forming protein Tsx precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZM7 at UniProt or InterPro

Protein Sequence (294 amino acids)

>BWI76_RS06335 nucleoside-specific channel-forming protein Tsx (Klebsiella michiganensis M5al)
MKKTLLAAGAALALSASFSASAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYMDAPVFFGGNTNAKGIWNHGSPLFMEIEPRFSIDKLTGTDLSFGP
FKEWYFANNYIYDMGRNKSGRQSTWYMGLGTDIDTGLPMSLSLNVYAKYQWQNYGASNEN
EWDGYRFKVKYFVPLTDLWGGSLSYIGFTNFDWGSDLGDDNSYDLNGKHSRTSNSIASSH
ILALNYDHWHYSVVARYFHNGGQWADDAKLNFGDGDFNVRATGWGGYFVVGYNF