Protein Info for BWI76_RS06265 in Klebsiella michiganensis M5al

Annotation: antibiotic biosynthesis monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 119 to 141 (23 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details PF03992: ABM" amino acids 12 to 80 (69 residues), 30.1 bits, see alignment E=4.4e-11 PF27539: Y2318_C" amino acids 112 to 178 (67 residues), 53.8 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K09932, hypothetical protein (inferred from 94% identity to kpn:KPN_00347)

Predicted SEED Role

"Antibiotic biosynthesis monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZE6 at UniProt or InterPro

Protein Sequence (181 amino acids)

>BWI76_RS06265 antibiotic biosynthesis monooxygenase (Klebsiella michiganensis M5al)
MAQQKSVTLVISHVLDPEHGQRYEAWLGKIMPIAAEFPGHLGANVIRPAPGQNLWSVIIR
FDTIEHLYAWTQSETRRQLVAEIAPLLSEGDRTEVRTEPAFWFTPPAVNVRQPRRWKQFL
ITLLVIFPSTNLVPSITGILLPSLKGSLLLHLINDACVVALVVWFWMPIVTRLFAGWLKK
N