Protein Info for BWI76_RS06040 in Klebsiella michiganensis M5al

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 168 (28 residues), see Phobius details amino acids 189 to 217 (29 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 422 to 448 (27 residues), see Phobius details amino acids 488 to 510 (23 residues), see Phobius details amino acids 522 to 542 (21 residues), see Phobius details amino acids 548 to 566 (19 residues), see Phobius details amino acids 610 to 633 (24 residues), see Phobius details amino acids 653 to 678 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 210 to 399 (190 residues), 53.7 bits, see alignment E=1.1e-18 amino acids 501 to 677 (177 residues), 41.2 bits, see alignment E=7.6e-15

Best Hits

Swiss-Prot: 68% identical to FBPB_ACTPL: Ferric transport system permease protein FbpB (fbpB) from Actinobacillus pleuropneumoniae

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 96% identity to cko:CKO_02820)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZD1 at UniProt or InterPro

Protein Sequence (692 amino acids)

>BWI76_RS06040 iron ABC transporter permease (Klebsiella michiganensis M5al)
MSHTLALHPVKKRDAIFLWVLFGWLAFALLPSWSLDYGLLESTSDEILAAYGWSQLNISW
LWYLLPSLLLIRPWQEARREQRSRHYLDAGWAFLCMAFIVVSATVEGRGLGYATIVLFVA
LGAIMTLALTRLEWLGGDRFVIGSLVAIVALIGVFIVWPSIAIFIPMFTNDAGEFAPLAF
MAVLSQAHIVQVIINSIGLSIAVGVGCTFFGLVLAIYTTRIAKRSAIIGRIFSILPIVTP
PFVVGLGVTLMMGRSGYVTELMVDWFGLTNTNWLYGFTGIWLAQVLAFTPMAFMILDGAI
KTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLIVIVQSLADFSNPLVLGGNFD
VLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQYMWIGKRSYVTVSGKSYRGDVQ
PLPVTLVWSVIAILAVWIAFNALLYGSIFYGSFTVNWGVDYTLTLDNFIKLFGQGMSDGA
WPSLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFKGKKTIEFTTMLCFAVPGTVAGVSYI
LAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQIDKSLDEASLSLRAGSLRTIT
HILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYG
SILIVVMLAIIFLFDWLIGEARISRSKAKNQA