Protein Info for BWI76_RS06035 in Klebsiella michiganensis M5al

Annotation: ferric transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00005: ABC_tran" amino acids 23 to 164 (142 residues), 135.7 bits, see alignment E=1.7e-43 PF08402: TOBE_2" amino acids 273 to 344 (72 residues), 49.3 bits, see alignment E=4.3e-17

Best Hits

Swiss-Prot: 94% identical to FBPC_ECOLI: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Escherichia coli (strain K12)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 94% identity to eco:b0262)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZB4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>BWI76_RS06035 ferric transporter ATP-binding subunit (Klebsiella michiganensis M5al)
MSQKNFVELRNVTKRFGSNMVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSE
GQIYIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGDNVGYGLKMLGVPRGDVKARVKEA
LAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIR
ELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQELYRQPASRFMASFMGDA
NLFPAAFSEDFVDIYGYRLPRPPHFAAHGEGSVGVRPEAITLSDRGEESQRCTIRHVAYM
GPQYEVTVEWHGQEILLQVNATRLQPDVGEHYYLEIHPYGMFVLADAG