Protein Info for BWI76_RS05985 in Klebsiella michiganensis M5al

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 232 to 245 (14 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 323 (288 residues), 119.9 bits, see alignment E=5.8e-39

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 96% identity to kpe:KPK_4386)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZA4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BWI76_RS05985 branched-chain amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MLNATTTAGAQLRNLVIIVLCVALLAGINVVFNDYIIRVISTIFVFMILAVSYNLINGVT
GQLSLEPNGFVAVGAYVTALLILSSDSKLDMFEMAAPSPWILVLHAGFLPALLISGLCAA
ALAVCLALPVFRVRGDYLAIVTLGFGFIIKILAINNPQITNGAIGLNDIPQQPHLLFWCG
LFALLATGMILQLVWSKYGRMMKAVRDDEDAAIAMGVNTFRIKTCAFATSAFFEGIGGGL
LASLLTTISPGLFDFMLTFQLLIIIVLGGLGSTTGALLGTVLVVGSGEWLRFLDQPLQFF
GHDLGAYPGLRMVVFSLLLLIIMLFAREGLLGKKEIWQVGKRGRGYGAK