Protein Info for BWI76_RS05955 in Klebsiella michiganensis M5al

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF00005: ABC_tran" amino acids 39 to 188 (150 residues), 132.8 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 55% identical to GLUA_COREF: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: None (inferred from 90% identity to kpu:KP1_1153)

MetaCyc: 53% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZF0 at UniProt or InterPro

Protein Sequence (272 amino acids)

>BWI76_RS05955 ABC transporter (Klebsiella michiganensis M5al)
MLSALFSRSAASSADFSHLQRASIEFRDVAKSYGDHRVLNGVNLQVEPGEVVAILGPSGS
GKSTLIRLINQLESLSGGEILIDGKPTRQLTGSALRQLRSRVGFVFQQFNLYAHLTAQEN
ITLALERVHGWGKSAARERSLALLSQVGLADKAGQMPAQLSGGQQQRVAIARALASSPQI
ILFDEPTSALDPEMIGEVLQVMKTLAHSGITMVVVTHEMQFAREIADRVVFIDGGDILEV
APPAEFFARPQHARTRRFLQKVLDPLHQESEA